HEX
Server: Apache/2
System: Linux da1 5.14.0-611.9.1.el9_7.x86_64 #1 SMP PREEMPT_DYNAMIC Thu Nov 27 10:37:27 EST 2025 x86_64
User: mdosdorg (1028)
PHP: 8.3.14
Disabled: exec,system,passthru,shell_exec,escapeshellarg,escapeshellcmd,proc_close,proc_open,dl,popen,show_source,posix_kill,posix_mkfifo,posix_getpwuid,posix_setpgid,posix_setsid,posix_setuid,posix_setgid,posix_seteuid,posix_setegid,posix_uname,mail
Upload Files
File: /home/mdosdorg/imap/mdo-sd.org/hr/Maildir/new/1766663531.M150002P297184.da1,S=12545,W=12842
Return-Path: <>
Delivered-To: hr@mdo-sd.org
Received: from da1.eurodns.top
	by da1.eurodns.top with LMTP
	id kFaOCGslTWngiAQAjUOyjQ
	(envelope-from <>)
	for <hr@mdo-sd.org>; Thu, 25 Dec 2025 13:52:11 +0200
Return-path: <>
Envelope-to: hr@mdo-sd.org
Delivery-date: Thu, 25 Dec 2025 13:52:11 +0200
Received: from mta-out-svc-03.tim.it ([217.169.118.21])
	by da1.eurodns.top with esmtps  (TLS1.3) tls TLS_AES_256_GCM_SHA384
	(Exim 4.98)
	id 1vYjt4-00000001FdL-2ilF
	for hr@mdo-sd.org;
	Thu, 25 Dec 2025 13:52:11 +0200
Received: from mta-06.mx.internal (10.62.170.77) by mta-out-svc-03.tim.it
        id 691C2A8903EE728B for hr@mdo-sd.org; Thu, 25 Dec 2025 12:52:10 +0100
To: hr@mdo-sd.org
From: Mail Administrator <Postmaster@tin.it>
Reply-To: Mail Administrator <Postmaster@tin.it>
Subject: Mail System Error - Returned Mail with Subject: ***SPAM*** Simple Rx, Quick Relief
Date: Thu, 25 Dec 2025 12:52:10 +0100
Message-ID: <20251225115210.PGLL7266.mta-06.mx.internal@mta-06>
MIME-Version: 1.0
Content-Type: multipart/report;
		report-type=delivery-status;
		Boundary="===========================_ _= 8352722(7266)1766663530"
Forward-Confirmed-ReverseDNS: Reverse and forward lookup success on 217.169.118.21, -10 Spam score
X-Spam-Bar: +
SpamTally: Final spam score: 4


--===========================_ _= 8352722(7266)1766663530
Content-Type: text/plain

This Message was undeliverable due to the following reason:

The user(s) account is temporarily over quota.

<jerixm@tin.it>

Please reply to <Postmaster@tin.it>
if you feel this message to be in error.

--===========================_ _= 8352722(7266)1766663530
Content-Type: message/delivery-status

Reporting-MTA: dns; mta-06.mx.internal
Arrival-Date: Thu, 25 Dec 2025 12:52:10 +0100
Received-From-MTA: dns; mta-in-02.tin.it (10.62.187.15)

Original-Recipient: rfc822;jerixm@tin.it
Final-Recipient: RFC822; <jerixm@tin.it>
Action: failed
Status: 4.2.4

--===========================_ _= 8352722(7266)1766663530
Content-Type: message/rfc822

Received: from mta-in-02.tin.it ([10.62.187.15]) by mta-06.mx.internal
          with ESMTP
          id <20251225115210.PGLI7266.mta-06.mx.internal@mta-in-02.tin.it>
          for <jerixm@tin.it>; Thu, 25 Dec 2025 12:52:10 +0100
X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgeefgedrtddtgdeiheehudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfvgffngfevqffokffvtefnkfetnecuuegrihhlohhuthemuceftddunecuogfuuhhsphgvtghtffhomhgrihhnucdlgeelmdenogfhohhrsghiugguvghnkfhpucdlhedttddmnecujfgurhepkfhrhffuffggtgesrgdtreertddtjeenucfhrhhomhepveetpfetfffktefpucfrjfettffoteevjgcuoehhrhesmhguohdqshgurdhorhhgqeenucggtffrrghtthgvrhhnpedvueduvdeigeevveehieekieehueeiffdtleejvddviedthfefhedvheejvdevieenucffohhmrghinhepthgvlhgvghhrrgdrphhhnecukfhppeelhedrvddujedrkedtrdduieekpdduvddurddukeeirddvgedtrddujeeknecuhfhorhgsihguuggvnhfkphepuddvuddrudekiedrvdegtddrudejkeenucfuphgrmhfkphfpvghtfihorhhkpeduvddurddukeeirddvgedtrddujeeknecuhfhorhgsihguuggvnhetlhhirghspeevtefpteffkfetpfcurffjteftofetvegjnecuufhprghmtehlphhhrgetlhhirghspegtrghnrgguihgrnhhphhgrrhhmrggthienucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopehmrghilhehrdhmrgiiihhnhhhoshhtrdhnvghtpdhinhgvthepleehrddvudejrdektddrudeikedpmhgrihhlfhhrohhmpehhrhesmhguohdqshgurdhorhhgpdhn
	sggprhgtphhtthhopedupdhrtghpthhtohepjhgvrhhigihmsehtihhnrdhithdprhgvvhfkrfepmhgrihhlhedrmhgriihinhhhohhsthdrnhgvthdpughkihhmpehfrghilhdpghgvohfkrfephffkpdfovfetjfhoshhtpehrrgiiohhrqdhinhdqthhinhdqtddv
X-RazorGate-Vade-Verdict: spam 549
X-RazorGate-Vade-Classification: spam
X-Razorgate-greyfolder: enabled
Received: from mail5.mazinhost.net (95.217.80.168) by mta-in-02.tin.it
        id 690232764046B614 for jerixm@tin.it; Thu, 25 Dec 2025 12:51:44 +0100
Received: from mail5.mazinhost.net (localhost [127.0.0.1])
	by mail5.mazinhost.net (Proxmox) with ESMTP id 01A9261E11
	for <jerixm@tin.it>; Thu, 25 Dec 2025 11:51:43 +0000 (UTC)
Received: from mail3.mazinhost.net (unknown [10.10.10.52])
	(using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits))
	(No client certificate requested)
	by mail5.mazinhost.net (Proxmox) with ESMTPS id 9016261DC6
	for <jerixm@tin.it>; Thu, 25 Dec 2025 11:51:39 +0000 (UTC)
X-Spam-Status: No
DKIM-Filter: OpenDKIM Filter v2.11.0 mail3.mazinhost.net 4dcRt33hLGzH103q
Authentication-Results: mail3.mazinhost.net;
	dkim=pass (2048-bit key) header.d=mdo-sd.org header.i=@mdo-sd.org header.b="PJecvxw4"
X-mazinhost-Watermark: 1767268297.04864@OVu+PQ7fW0kDpN9vDrko8w
X-mazinhost-From: hr@mdo-sd.org
X-mazinhost-SpamScore: sssss
X-mazinhost: Please contact postmaster@mazinhost.com for details
X-mazinhost-ID: 4dcRsg5pvnzGs9Lc
X-mazinhost-Information: Please contact postmaster@mazinhost.com for more information
Received: from da1.eurodns.top (da1.eurodns.top [89.163.214.37])
	(using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits))
	(no client certificate requested)
	by mail3.mazinhost.net (MailScanner Milter) with SMTP id 4dcRsg5pvnzGs9Lc;
	Thu, 25 Dec 2025 13:51:34 +0200 (CAT)
DKIM-Filter: OpenDKIM Filter v2.11.0 mail3.mazinhost.net 4dcRsg5pvnzGs9Lc
DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=mdo-sd.org;
	s=x; h=Content-Type:MIME-Version:Date:Subject:From:Reply-To:Message-ID:Sender
	:To:Cc:Content-Transfer-Encoding:Content-ID:Content-Description:Resent-Date:
	Resent-From:Resent-Sender:Resent-To:Resent-Cc:Resent-Message-ID:In-Reply-To:
	References:List-Id:List-Help:List-Unsubscribe:List-Subscribe:List-Post:
	List-Owner:List-Archive; bh=zwIAqaK62LV2m3IaD+3Y7Udtn8DpVTFJrdkgn622ef4=; b=P
	Jecvxw4oiJF4VOOKBc/f476Df8p6PxXofQ4VLzGczpepBVUyCF3tOd8KTNjsRp5Xqrez97Qp8cs3B
	u/1wuseCZgp58YsBJ8GtXmPJf7aLpLdzRwVTcKLqdb3sIEDWdC9wbKssmVdxwHvP14rrd7N/Go/aD
	l1OVkrK3fW421OrSXm2L7x7rgiFjdUQhqsoinA4W5uDZsapF3qyjZEQi9dxpP6kStSJ0t3OQn2PAy
	+ApdKJ/+ik/r4wgTu90dLzReRR6Ynvvt/3uBA5C5N/YaKLXiWEA+ZVZ1s/WIoUzfpJK1Ge/yUmofC
	3xlmbZRxDdyDdRtj+GbghTv6CRbeAGt8A==;
Received: from [121.186.240.178] (helo=213.5.130.100)
	by da1.eurodns.top with esmtpsa  (TLS1.3) tls TLS_AES_256_GCM_SHA384
	(Exim 4.98)
	(envelope-from <hr@mdo-sd.org>)
	id 1vYjsT-00000001Fa1-2kme;
	Thu, 25 Dec 2025 13:51:34 +0200
Message-ID: <0d0e8823d7133932156f268d1da982aa4fb37a@mdo-sd.org>
Reply-To: =?utf-8?B?Q0FOQURJ4oCLQeKAi04gUEhB4oCLUk1BQ1k=?= <hr@mdo-sd.org>
From: =?utf-8?B?Q0FOQURJ4oCLQeKAi04gUEhB4oCLUk1BQ1k=?= <hr@mdo-sd.org>
subject: ***SPAM*** Simple Rx, Quick Relief
Date: Thu, 25 Dec 2025 14:51:11 +0300
MIME-Version: 1.0
Content-Type: multipart/alternative; boundary="a0b2fb50a4604a45b61c559a1edbd24237d9"
X-Authenticated-Id: hr@mdo-sd.org
X-SPAM-LEVEL: Spam detection results:  13
	BAYES_00                 -1.9 Bayes spam probability is 0 to 1%
	CBJ_GiveMeABreak         1.75 Messages with consecutive break characters
	DKIM_SIGNED               0.1 Message has a DKIM or DK signature, not necessarily valid
	DKIM_VALID               -0.1 Message has at least one valid DKIM or DK signature
	DKIM_VALID_AU            -0.1 Message has a valid DKIM or DK signature from author's domain
	DKIM_VALID_EF            -0.1 Message has a valid DKIM or DK signature from envelope-from domain
	DMARC_MISSING             0.1 Missing DMARC policy
	HTML_MESSAGE            0.001 HTML included in message
	KAM_TELEGRA                 5 Service being exploited by spammers
	MISSING_HEADERS         1.021 Missing To: header
	RCVD_HELO_IP_MISMATCH   2.368 Received: HELO and IP do not match, but should
	RCVD_IN_BL_SPAMCOP_NET  1.347 Received via a relay in bl.spamcop.net
	REPLYTO_WITHOUT_TO_CC   1.552 -
	SCC_META_ODDDIV8        1.998 ODDDIV8 is most odd many times.
	SPF_HELO_NONE           0.001 SPF: HELO does not publish an SPF Record
	URIBL_DBL_BLOCKED_OPENDNS  0.001 ADMINISTRATOR NOTICE: The query to dbl.spamhaus.org was blocked due to usage of an open resolver. See https://www.spamhaus.org/returnc/pub/ [telegra.ph,mdo-sd.org]

--a0b2fb50a4604a45b61c559a1edbd24237d9
Content-Type: text/plain; charset="utf-8"
Content-Transfer-Encoding: quoted-printable

=C2=A0Moderate exercise enhances blood flow and overall performance.

https://telegra.ph/FROM-12-21-60119

colloquy of the bishops and other clergy, who were convoked at Poissy,pla=
nned to reach by filling thousands of sacks with sand and gravel

[814] Upon the details of this famous tour see _Correspondance de

Some of the scenes thus revealed were of immeasurable grandeur and ofbeco=
me too great, and we break. But King Laugh he come like the

with anguish. He recalled all the inward conflict of the preceding

=E2=80=9CI should like very, very much to know, Dmitri Prokofitch... how =
he

pulled him from the sofa.

charitable enterprise, and the good deed is done, almost as soon asseems =
to me a very plain one, which reconciles truth, honour andcorruptions, wo=
uld hear it reported on every hand that he had a demon.

part, the result of affliction. The less it was occupied with healthy

popular street character of the time, was impressed as an additionalcreat=
ure he had since cared for and parted with, had died on the

But in the name of what principle can Comte discern what is and what is

or metaphysical manner: _C=C5=93li enarrant gloriam Dei_. He does not adm=
itamong themselves, and could he have imposed upon them a disciplinein it=
s continuous evolution, that is to say in its religions, in its

--a0b2fb50a4604a45b61c559a1edbd24237d9
Content-Type: text/html; charset="utf-8"
Content-Transfer-Encoding: quoted-printable

<html>
<head>
<meta http-equiv=3D"Content-Type" content=3D"text/html; charset=3Dutf-8">
</head>
<body bgColor=3D"#ffffff">
<div align=3Dleft><font size=3D2 face=3DArial>&nbsp;Moderate exercise enh=
ances blood flow and overall performance.=20
<div>&nbsp;</div>
<div>https://telegra.ph/FROM-12-21-60119</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>
<div>colloquy of the bishops and other clergy, who were convoked at Poiss=
y,planned to reach by filling thousands of sacks with sand and gravel</di=
v>
<div>&nbsp;</div>
<div>[814] Upon the details of this famous tour see _Correspondance de</d=
iv>
<div>&nbsp;</div>
<div>Some of the scenes thus revealed were of immeasurable grandeur and o=
fbecome too great, and we break. But King Laugh he come like the</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>with anguish. He recalled all the inward conflict of the preceding</=
div>
<div>=E2=80=9CI should like very, very much to know, Dmitri Prokofitch...=
 how he</div>
<div>pulled him from the sofa.</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>charitable enterprise, and the good deed is done, almost as soon ass=
eems to me a very plain one, which reconciles truth, honour andcorruption=
s, would hear it reported on every hand that he had a demon.</div>
<div>&nbsp;</div>
<div>part, the result of affliction. The less it was occupied with health=
y</div>
<div>popular street character of the time, was impressed as an additional=
creature he had since cared for and parted with, had died on the</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>But in the name of what principle can Comte discern what is and what=
 is</div>
<div>or metaphysical manner: _C=C5=93li enarrant gloriam Dei_. He does no=
t admitamong themselves, and could he have imposed upon them a discipline=
in its continuous evolution, that is to say in its religions, in its</div=
></div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div>
<div>&nbsp;</div></font></div></body></html>

--a0b2fb50a4604a45b61c559a1edbd24237d9--


--===========================_ _= 8352722(7266)1766663530--